DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Mcpt3

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001163937.1 Gene:Mcpt3 / 290244 RGDID:735036 Length:246 Species:Rattus norvegicus


Alignment Length:258 Identity:78/258 - (30%)
Similarity:121/258 - (46%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQ---------VSLQRSYHFCGGSLIA 72
            ||:..:||.:   ||...      .|:||    ::.||:.         |:.:....||||.||:
  Rat     5 LFLMALLLPS---GAGAE------EIIGG----VESIPHSRPYMALLKIVTEEGHVTFCGGFLIS 56

  Fly    73 QGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSA 137
            ..:|:|||||......::......|.|.|. .|.:.:::...:||::.::...|..||:|||.:.
  Rat    57 HLFVMTAAHCRGKEITVILGAHDMSKREST-QQKIKVEKQIFYPKYNFFSNFHDIMLLKLEEKAV 120

  Fly   138 KNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSIT 202
            ...|...:.||:....|..|.....:|||.|...:.||..||.|.:..:.:..|    ..|....
  Rat   121 LTPTVNVIPLPQSSDFIKPGKMCWAAGWGRTGVTEPTSDTLREVKLRIMEKKAC----WYFWHYD 181

  Fly   203 DR-MLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264
            :| .:|.|.||..|...:.||||||...||..|:||.|.|..:|  |.:::|:|:...||.:|
  Rat   182 NRFQICVGSPEMLKLTYKEDSGGPLVCAGVAHGIVSHGRGRGKP--PIIFTRISSYVPWIDTV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 69/229 (30%)
Tryp_SPc 42..264 CDD:238113 71/231 (31%)
Mcpt3NP_001163937.1 Tryp_SPc 20..239 CDD:214473 69/229 (30%)
Tryp_SPc 21..242 CDD:238113 71/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.