DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss38

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:261 Identity:82/261 - (31%)
Similarity:128/261 - (49%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLT 78
            ||||          |.:...:|.|.|:::||::...:..|:|||:. ..:|.||||::...||||
  Rat    97 LHLF----------LSSACGQPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLT 151

  Fly    79 AAHC--------TEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAY-TIDFDFSLLELEE 134
            ||||        |....:.::.:.:.:..|    |...|.:|..||.|:.: .:..|.:|::.:.
  Rat   152 AAHCFAREKRLQTFDMYVGITNLEVANKHT----QWFEINQVIIHPTFEMFHPVGGDVALVQSKS 212

  Fly   135 YSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFG 199
            ....:.....:.||..:.:::| .....:|||......||...|....:|.:.:.||...||...
  Rat   213 AIVFSDYVLPICLPSSNLNLSD-LSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTS 276

  Fly   200 SITDRMLCAGLPEGGKDACQGDSGGPLAAD-GVLW---GVVSWGYGCARPNYPGVYSRVSAVRDW 260
            .:...|||||..:..|:.|:||||.||... ...|   |:||||.|||:|.||||::.||...:|
  Rat   277 YLLPEMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNW 341

  Fly   261 I 261
            |
  Rat   342 I 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 72/233 (31%)
Tryp_SPc 42..264 CDD:238113 74/234 (32%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 74/232 (32%)
Tryp_SPc 116..342 CDD:214473 72/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.