DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss29

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:288 Identity:104/288 - (36%)
Similarity:135/288 - (46%) Gaps:42/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSSIGLTGMAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSY-- 63
            |.|.:|||       .:|:|..:   ..:.|:|....|.| ||||..|.....|:|||| |.|  
  Rat     1 MLSQLGLT-------LIFLGSSI---AGIPASVPEDVLVG-IVGGNSAPQGKWPWQVSL-RVYRY 53

  Fly    64 ------HFCGGSLIAQGWVLTAAHCTEGSAILLSKVRI--GSSRTSVGGQLVGIKRVHRHPKFDA 120
                  |.||||:|...||||||||...|....|..||  |......|.:|:.:.||..||.|..
  Rat    54 NWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYLGQVYLYGGEKLLKVSRVIIHPDFVR 118

  Fly   121 YTIDFDFSLLELEE--YSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAV--LRSV 181
            ..:..|.:||:|.:  .|..||..  |.|.....::.......|:|||:....:.....  |:.|
  Rat   119 SGLGSDVALLQLAQSVRSFPNVKP--VKLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQV 181

  Fly   182 TVPKVSQTQCTEAYGNFGSITDR--------MLCAGLPEGGKDACQGDSGGPLAAD----GVLWG 234
            .|..|..|.|.:.|.|...:::.        |||||  ..|:|:|.|||||||..:    ..|.|
  Rat   182 QVKIVDNTLCEKLYRNATRLSNHGQRLILQDMLCAG--SHGRDSCYGDSGGPLVCNVTGSWTLVG 244

  Fly   235 VVSWGYGCARPNYPGVYSRVSAVRDWIS 262
            |||||||||..:.||||:||.....||:
  Rat   245 VVSWGYGCALKDIPGVYARVQFFLPWIT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 91/245 (37%)
Tryp_SPc 42..264 CDD:238113 93/247 (38%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.