DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss30

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:285 Identity:109/285 - (38%)
Similarity:139/285 - (48%) Gaps:64/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTGMAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSL--QRSYHFCGGS 69
            |||....|||            .||        |:|||||.|.....|:||||  ::..|.||||
  Rat    16 LTGGRGDILH------------SGA--------GKIVGGQDAPEGRWPWQVSLRTEKEGHICGGS 60

  Fly    70 LIAQGWVLTAAHC----TEGSAILLSKVRIGS---SRTSVGGQLVGIKRVHRHPKF---DAYTID 124
            ||.:.||||||||    ...|   ...|::|.   |.|.....||.::.:..:|.:   ||.:  
  Rat    61 LIHEVWVLTAAHCFCRPLNSS---FYHVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASS-- 120

  Fly   125 FDFSLLELE------EYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTV 183
            .|.:||.|:      ::|.       |.||:..|.:..||...|:|||.|.. :|.::||:.:.|
  Rat   121 GDIALLRLDTPLQPSQFSP-------VCLPQAQAPLTPGTVCWVTGWGATHE-RELASVLQELAV 177

  Fly   184 PKVSQTQCTEAYGNFGS--------ITDRMLCAGLPEGGKDACQGDSGGPL-AADGVLW---GVV 236
            |.:....|...| :.|.        |...|||||..||.||:||||||||| .|....|   |:.
  Rat   178 PLLDSEDCERMY-HIGETSLSGKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGIT 241

  Fly   237 SWGYGCARPNYPGVYSRVSAVRDWI 261
            |||.||||||.||||:||....|||
  Rat   242 SWGIGCARPNKPGVYTRVPDYVDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 98/249 (39%)
Tryp_SPc 42..264 CDD:238113 100/250 (40%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.