DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and LOC286960

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:239 Identity:97/239 - (40%)
Similarity:133/239 - (55%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGATVRRP-RLDGRIVGGQVANIKDIPYQVSLQRSY-HFCGGSLIAQGWVLTAAHCTEGSAILLS 91
            |||.|..| ..|.:||||.......:||||||.... |.||||||:..|||:||||.:...    
  Rat    10 LGAAVALPVNDDDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKL---- 70

  Fly    92 KVRIGSSRTSV---GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDAD 153
            :||:|.....|   |.|.:..:::.|||:::..|:|.|..|::|:..:..|...:.|.||...| 
  Rat    71 QVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCA- 134

  Fly   154 IADGTPVLVSGWGNTQS-AQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDA 217
             :.....||||||||.| ..:..|:|:.:..|.:|.:.|.::|.  |.||..|.|.|..|||||:
  Rat   135 -STDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYP--GQITSNMFCLGFLEGGKDS 196

  Fly   218 CQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            |.||||||:..:|.:.|:||||..||....||||::|.....||
  Rat   197 CDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 89/224 (40%)
Tryp_SPc 42..264 CDD:238113 91/225 (40%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 89/224 (40%)
Tryp_SPc 24..243 CDD:238113 91/225 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3235
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.