DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and KLK9

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:257 Identity:89/257 - (34%)
Similarity:121/257 - (47%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSYH----FCGGSLIAQGWVLTAAH 81
            |:|...|||.|  .....|.|.:|.:.......|:|..|   :|    |||.:||:..|:|||||
Human     4 GLLCALLSLLA--GHGWADTRAIGAEECRPNSQPWQAGL---FHLTRLFCGATLISDRWLLTAAH 63

  Fly    82 CTEGSAILLSKVRIGSS---RTSVGGQLVGIKRVHRHPKFD----AYTIDFDFSLLELEEYSAKN 139
            |.:.    ...||:|..   :.....||..:.....||.|:    |...:.|..|:.|...:  .
Human    64 CRKP----YLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQA--R 122

  Fly   140 VTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAV-LRSVTVPKVSQTQCTEAYGNFGSITD 203
            ::.|...|......::.|...|:||||...|.:....| |:...:..:....|..||.  |.|:|
Human   123 LSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYP--GHISD 185

  Fly   204 RMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWISSV 264
            .||||||.|||:.:|||||||||..:|.|.||||.| ..|:||..|.||:.|....|||..:
Human   186 SMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 80/232 (34%)
Tryp_SPc 42..264 CDD:238113 81/234 (35%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.