DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and KLK13

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:270 Identity:100/270 - (37%)
Similarity:130/270 - (48%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LHLFIGGILLVNLSLGATVRRPRL------DGRIVGGQVANIKDIPYQVS-LQRSYHFCGGSLIA 72
            |.|.|..:.|. ||.|.:....::      .|.:.||........|:|.: |.:....|||.|:.
Human     4 LALVIASLTLA-LSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLLCGGVLVH 67

  Fly    73 QGWVLTAAHC-TEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKF----DAYTIDFDFSLLEL 132
            ..|||||||| .||..:.|.|..:|  |...|.|:..:.....||::    .....|.|..||||
Human    68 PKWVLTAAHCLKEGLKVYLGKHALG--RVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLEL 130

  Fly   133 EEYSAKNVTQAFVGLP-EQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKV---------S 187
            :  |...:|.....|| ..:..:..||...|||||.|.|.|        |..||.         |
Human   131 Q--SPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWGTTTSPQ--------VNYPKTLQCANIQLRS 185

  Fly   188 QTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVY 251
            ..:|.:.|.  |.|||.|||||..|||||:|:|||||||..:..|:|:|||| :.|.:|:.||||
Human   186 DEECRQVYP--GKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVY 248

  Fly   252 SRVSAVRDWI 261
            :|||....||
Human   249 TRVSRYVLWI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 90/236 (38%)
Tryp_SPc 42..264 CDD:238113 92/237 (39%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 92/235 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8511
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.