DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and PRSS33

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:268 Identity:104/268 - (38%)
Similarity:134/268 - (50%) Gaps:27/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSLGATVRR-------PRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLT 78
            :||:.|....|..|       ||:..|||||:.....:.|:|.|:| |..|.|||||||..||||
Human    10 LLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLT 74

  Fly    79 AAHCTEGSAILLS-KVRIGSSR---TSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKN 139
            ||||....|:... :||:|:.|   ||.....|.::||...|.:.......|.:||:|......:
Human    75 AAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLS 139

  Fly   140 VTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETS--AVLRSVTVPKVSQTQCTEAYGNFGS-- 200
            .....|.||...|....|||..|:|||:.:......  ..|:.|.||.:....|...| :.|:  
Human   140 ARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLY-HVGADV 203

  Fly   201 ------ITDRMLCAGLPEGGKDACQGDSGGPL----AADGVLWGVVSWGYGCARPNYPGVYSRVS 255
                  :....||||.|:|.||||||||||||    :...||.||||||.|||.||.||||:.|:
Human   204 PQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVA 268

  Fly   256 AVRDWISS 263
            ....||.:
Human   269 TYSPWIQA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 95/238 (40%)
Tryp_SPc 42..264 CDD:238113 96/241 (40%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 95/238 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.