DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss1

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:244 Identity:105/244 - (43%)
Similarity:138/244 - (56%) Gaps:13/244 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSLGATVRRP-RLDGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGS 86
            ||:...:||.|..| ..|.:||||.......:||||||...|||||||||...||::||||.:..
  Rat     4 LLILALVGAAVAFPLEDDDKIVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSR 68

  Fly    87 AILLSKVRIGSSRTSV---GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLP 148
            .    :||:|....:|   ..|.:...::.:||.:.::|::.|..|::|......|...|.|.||
  Rat    69 I----QVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALP 129

  Fly   149 EQDADIADGTPVLVSGWGNTQS-AQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPE 212
            ...|..  ||..|:||||||.| ......:|:.|..|.:||..|..||.  |.||..|:|.|..|
  Rat   130 SACAPA--GTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYP--GEITSSMICVGFLE 190

  Fly   213 GGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            ||||:||||||||:..:|.|.|:||||||||.|:.||||::|.....||
  Rat   191 GGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 96/223 (43%)
Tryp_SPc 42..264 CDD:238113 98/224 (44%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 96/223 (43%)
Tryp_SPc 24..242 CDD:238113 98/224 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3235
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm8983
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.