DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss58

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_778185.1 Gene:Prss58 / 232717 MGIID:3608323 Length:241 Species:Mus musculus


Alignment Length:210 Identity:59/210 - (28%)
Similarity:98/210 - (46%) Gaps:6/210 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKF 118
            ||.|.|:..|..|.|.||...||:|||||...:..::..:...:.......::...:::..||.|
Mouse    29 PYLVYLKSDYLPCTGVLIHPLWVITAAHCNLPNLQVILGITNPADPMERDVEVSDYEKIFHHPNF 93

  Fly   119 DAYTIDFDFSLLELE-EYSAKNVTQAFVGLPEQDADIADGTPVLVSGWG-NTQSAQETSAVLRSV 181
            ...:|..|..|::|: .....|..:| |.||:....:  .....||.|. |.....:....|::|
Mouse    94 LVSSISHDLLLIKLKRRIKHSNYAKA-VKLPQHIVSV--NAMCSVSTWAYNLCDVTKDPDSLQTV 155

  Fly   182 TVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPN 246
            .|..:|:.:|..||..| .||:.|:|.|:..|.:..|:..:..|...:|||:|::|:..||....
Mouse   156 NVTVISKAECRNAYKAF-DITENMICVGIVPGRRLPCKEVTAAPAVCNGVLYGILSYADGCVLRA 219

  Fly   247 YPGVYSRVSAVRDWI 261
            ..|:|:.:.....||
Mouse   220 DVGIYASIFHYLPWI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 57/208 (27%)
Tryp_SPc 42..264 CDD:238113 59/210 (28%)
Prss58NP_778185.1 Tryp_SPc 29..237 CDD:238113 59/210 (28%)
Tryp_SPc 29..234 CDD:214473 57/208 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.