DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Tpsb2

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:280 Identity:110/280 - (39%)
Similarity:142/280 - (50%) Gaps:40/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MAKTILHLFIGGILLVNLSLGATVRRPRLDGR---IVGGQVANIKDIPYQVSL--QRSY--HFCG 67
            |.|.:|.|.....||.:|...|    ||...:   ||||..|:....|:||||  :.:|  ||||
Mouse     1 MLKRLLLLLWALSLLASLVYSA----PRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCG 61

  Fly    68 GSLIAQGWVLTAAHCTEGSAI---LLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTID--FDF 127
            ||||...||||||||. |..|   .|.:|::.......|.||:.:.|:..||.:  ||.:  .|.
Mouse    62 GSLIHPQWVLTAAHCV-GPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHY--YTAEGGADV 123

  Fly   128 SLLELEEYSAKNVTQAF--VGLPEQDADIADGTPVLVSGWGNTQSAQETSA--VLRSVTVPKVSQ 188
            :|||||  ...||:...  :.||........||...|:|||:..:.:....  .|:.|.||.|..
Mouse   124 ALLELE--VPVNVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVEN 186

  Fly   189 TQCTEAY-------GNFGSITDRMLCAGLPEGGKDACQGDSGGPLA--ADGVLW---GVVSWGYG 241
            :.|...|       .:|..:.|.|||||  ...:|:|||||||||.  ..|. |   ||||||.|
Mouse   187 SLCDRKYHTGLYTGDDFPIVHDGMLCAG--NTRRDSCQGDSGGPLVCKVKGT-WLQAGVVSWGEG 248

  Fly   242 CARPNYPGVYSRVSAVRDWI 261
            ||:||.||:|:||:...|||
Mouse   249 CAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 98/247 (40%)
Tryp_SPc 42..264 CDD:238113 100/245 (41%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 100/245 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.