DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Gzma

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_034500.1 Gene:Gzma / 14938 MGIID:109266 Length:260 Species:Mus musculus


Alignment Length:275 Identity:91/275 - (33%)
Similarity:134/275 - (48%) Gaps:31/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSSIGLTGMA-KTILHLFI---GGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQR 61
            ||::.|..|.: .|:|.|.:   ||.                 .||:||........||...|:.
Mouse     1 MRNASGPRGPSLATLLFLLLIPEGGC-----------------ERIIGGDTVVPHSRPYMALLKL 48

  Fly    62 SYH-FCGGSLIAQGWVLTAAHCTEGSAILLSKVRIG--SSRTSVGGQLVGIKRVHRHPKFDAYTI 123
            |.: .|.|:||.:.||||||||..|..   ||..:|  |.......|::.:|:...:|.:|.||.
Mouse    49 SSNTICAGALIEKNWVLTAAHCNVGKR---SKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTR 110

  Fly   124 DFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQ 188
            :.|..|:.|::.:..|...|.:.||::..|:..||...|:|||...:....|..||.|.:..:.:
Mouse   111 EGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDR 175

  Fly   189 TQCT-EAYGNFGSITD-RMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSW-GYGCARPNYPGV 250
            ..|. |.:.||..:.. .|:|||...||||:|.||||.||..||:|.|:.|: |..|....:|||
Mouse   176 KICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGV 240

  Fly   251 YSRVSAVR-DWISSV 264
            |:.:|... :||..:
Mouse   241 YTFLSDKHLNWIKKI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 80/226 (35%)
Tryp_SPc 42..264 CDD:238113 81/228 (36%)
GzmaNP_034500.1 Tryp_SPc 28..252 CDD:214473 80/226 (35%)
Tryp_SPc 29..255 CDD:238113 81/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.