DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and PRSS36

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:247 Identity:88/247 - (35%)
Similarity:115/247 - (46%) Gaps:20/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RPRLDGRIVGGQVANIKDIPYQVSLQR-SYHFCGGSLIAQGWVLTAAHC--TEGSAILLSKVRIG 96
            ||....|||||..|.....|:||||.. ..|.|||||||..|||:||||  |.|:....::..:.
Human    40 RPEPSARIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVL 104

  Fly    97 SSRTSVGGQLVG-----IKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIAD 156
            ....|..|.|.|     :..:.....:....:..|.:||.|...::.......|.||........
Human   105 LGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASPASLGPAVWPVCLPRASHRFVH 169

  Fly   157 GTPVLVSGWGNTQSAQETSA--VLRSVTVPKVSQTQCTEAYGNFG------SITDRMLCAGLPEG 213
            ||....:|||:.|.|.....  ||:.|.:..:.:..|...|...|      .|...|||||.|||
Human   170 GTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEG 234

  Fly   214 GKDACQGDSGGPLAA-DGVLW---GVVSWGYGCARPNYPGVYSRVSAVRDWI 261
            .:|.|||||||||.. :|..|   |:.|:|:||.|.|.|||::.|:....||
Human   235 RRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 84/239 (35%)
Tryp_SPc 42..264 CDD:238113 85/240 (35%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 84/239 (35%)
Tryp_SPc 47..289 CDD:238113 85/240 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.