DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and PRSS37

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_005250003.1 Gene:PRSS37 / 136242 HGNCID:29211 Length:265 Species:Homo sapiens


Alignment Length:277 Identity:60/277 - (21%)
Similarity:94/277 - (33%) Gaps:107/277 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PYQVSLQRSYHFCGGSLIAQGWVLTAAHC-TEGSAILL----SKVRIGSSRTSVGGQLVGIKRVH 113
            ||.|.|:..::.|.|.||...|||..||| .....::|    |:||.|:.:|....|:|      
Human    28 PYLVYLKSHFNPCVGVLIKPSWVLAPAHCYLPNLKVMLGNFKSRVRDGTEQTINPIQIV------ 86

  Fly   114 RHPKFDAYTIDFDFSLLELEEYSAKN-----VTQAFVGLPEQDADIADGTPVLVSG--WGNTQSA 171
            |:..:.......|..|::|.:.:..|     :|.|       ..::..||..|:||  |     :
Human    87 RYWNYSHSAPQDDLMLIKLAKPAMLNPKVQPLTLA-------TTNVRPGTVCLLSGLDW-----S 139

  Fly   172 QETSAV---------------------------------LR-SVTVPKVSQTQC--TE---AYGN 197
            ||.|.:                                 || ::..|.:|..:|  ||   ::.|
Human   140 QENSGLWQLEPPGHLTLHRGPAIPDWQRHNSHEQGRHPDLRQNLEAPVMSDRECQKTEQGKSHRN 204

  Fly   198 -------------FGSI-TDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYP 248
                         ||.: ...::|       ||..||...|......|                 
Human   205 SLCVKFVKVFSRIFGEVAVATVIC-------KDKLQGIEVGHFMGGDV----------------- 245

  Fly   249 GVYSRVSAVRDWISSVS 265
            |:|:.|.....||.:.:
Human   246 GIYTNVYKYVSWIENTA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 58/271 (21%)
Tryp_SPc 42..264 CDD:238113 60/274 (22%)
PRSS37XP_005250003.1 Tryp_SPc 28..261 CDD:304450 60/274 (22%)
Tryp_SPc 28..258 CDD:214473 58/271 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.