DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and CMA1

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001827.1 Gene:CMA1 / 1215 HGNCID:2097 Length:247 Species:Homo sapiens


Alignment Length:230 Identity:74/230 - (32%)
Similarity:113/230 - (49%) Gaps:11/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GRIVGGQVANIKDIPYQVSLQ-----RSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSR 99
            |.|:||........||...|:     ....||||.||.:.:|||||||. |.:|.::......:.
Human    20 GEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCA-GRSITVTLGAHNITE 83

  Fly   100 TSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSG 164
            .....|.:.:.:..||||::..|:..|..||:|:|.::..:....:..|.|...:..|....|:|
Human    84 EEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAG 148

  Fly   165 WGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAAD 229
            ||.|...:..|..|:.|.:..:....|:. :.:|..  :..||.|.|...|.|.:|||||||...
Human   149 WGRTGVLKPGSDTLQEVKLRLMDPQACSH-FRDFDH--NLQLCVGNPRKTKSAFKGDSGGPLLCA 210

  Fly   230 GVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISSV 264
            ||..|:||:|...|:|  |.|::|:|..|.||:.:
Human   211 GVAQGIVSYGRSDAKP--PAVFTRISHYRPWINQI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 71/224 (32%)
Tryp_SPc 42..264 CDD:238113 73/226 (32%)
CMA1NP_001827.1 Tryp_SPc 22..243 CDD:238113 73/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.