DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Prss28

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:274 Identity:87/274 - (31%)
Similarity:125/274 - (45%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLS--------LGATVRRPRLDGRIVGGQVANIKDIPYQVSLQR-SY------HFCGGSLI 71
            :||:.||        ...::.|.:..| |||||.......|:||||:. ||      |.||||:|
Mouse     4 LLLLALSCLESTVFMASVSISRSKPVG-IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSII 67

  Fly    72 AQGWVLTAAHC--TEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEE 134
            ...|:||||||  ::.:...:.:|::|........:|:.|.|:..||.::..:..||.:|::|..
Mouse    68 HPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQLTA 132

  Fly   135 YSAKNVTQAFVGLPEQDADIADGTPVLVSGWGN--TQSAQETSAVLRSVTVPKVSQTQCTEAYGN 197
            ....:...:.|.||:..:.........:.||||  .:...:....|..|.:|......|..||..
Mouse   133 LLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRK 197

  Fly   198 FGS-------ITDRMLCAGLPEGGKDACQGDSGGPLAADGVLW--------GVVSWGYGCARPNY 247
            ..|       |.|.|||||  ..|:..|.|||||||    |.|        ||||.|..|:. |.
Mouse   198 KSSDEHKAVAIFDDMLCAG--TSGRGPCFGDSGGPL----VCWKSNKWIQVGVVSKGIDCSN-NL 255

  Fly   248 PGVYSRVSAVRDWI 261
            |.::|||.:...||
Mouse   256 PSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 79/245 (32%)
Tryp_SPc 42..264 CDD:238113 81/246 (33%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 81/246 (33%)
Tryp_SPc 31..269 CDD:214473 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.