DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and LOC101730988

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_012810074.1 Gene:LOC101730988 / 101730988 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:246 Identity:105/246 - (42%)
Similarity:142/246 - (57%) Gaps:14/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGS 86
            :||:.:.|||.....  |.:|:||.......:||.|||...||||||||:...||::||||.:.|
 Frog     3 LLLICVLLGAAAAFD--DDKIIGGATCAKNSVPYIVSLNAGYHFCGGSLLNNQWVVSAAHCYQAS 65

  Fly    87 AILLSKVRIGSSRTSVG---GQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLP 148
            .    :||:|....::.   .|.:...:|.|||.:::.|.|.|..|::|...::.|.....|.||
 Frog    66 I----QVRLGEHNIALSEGTEQFINSAKVIRHPSYNSRTTDNDIMLIKLASPASLNSYVKAVSLP 126

  Fly   149 EQDADIADGTPVLVSGWGNTQ-SAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPE 212
            ...|  |.||..||||||||. |......:|:.:..|.::..||:.||.  |.||:.|.|||..|
 Frog   127 SSCA--AAGTSCLVSGWGNTSASGSNYPNLLQCLNAPILTTAQCSSAYP--GQITNNMFCAGFLE 187

  Fly   213 GGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISS 263
            ||||:||||||||:..:|.|.|:||||.|||:.||||||::|.....||.|
 Frog   188 GGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQRNYPGVYAKVCNYNSWIQS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 96/223 (43%)
Tryp_SPc 42..264 CDD:238113 99/226 (44%)
LOC101730988XP_012810074.1 Tryp_SPc 21..239 CDD:238113 99/226 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3316
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134055
Inparanoid 1 1.050 190 1.000 Inparanoid score I3758
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm9407
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.