DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and Klk9

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:258 Identity:89/258 - (34%)
Similarity:123/258 - (47%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GILLVNLSL-----GATVRRPRLDGRIVGGQVANIKDIPYQVSL-QRSYHFCGGSLIAQGWVLTA 79
            |:.||..||     ||       |.|.||.:.......|:|..| ..:...||.:||...|:|||
Mouse     4 GLTLVLFSLLAGHCGA-------DTRAVGARECVRNSQPWQAGLFYLTRQLCGATLINDQWLLTA 61

  Fly    80 AHCTEGSAILLSKVRIGSS---RTSVGGQLVGIKRVHRHPKFD----AYTIDFDFSLLELEEYSA 137
            |||.:.    ...||:|..   |.....||:.:.....||.|:    |...:.|..|:.|..  .
Mouse    62 AHCRKP----YLWVRLGEHHLWRWEGPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPR--K 120

  Fly   138 KNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQ-ETSAVLRSVTVPKVSQTQCTEAYGNFGSI 201
            ..:|.|...|...::....||..|:||||:..|:: :....|:...:..:....|..||.  |.|
Mouse   121 VRLTPAVQPLNLTESRPPVGTQCLISGWGSVSSSKLQYPMTLQCANISILDNKLCRWAYP--GHI 183

  Fly   202 TDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWISS 263
            :::||||||.|||:.:|||||||||..:|.|.|:||.| ..|:||..|.||:.|....:||.|
Mouse   184 SEKMLCAGLWEGGRGSCQGDSGGPLVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFDYLEWIES 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 78/229 (34%)
Tryp_SPc 42..264 CDD:238113 80/232 (34%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.