DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and prss59.2

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:227 Identity:99/227 - (43%)
Similarity:135/227 - (59%) Gaps:11/227 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVG 103
            |.:||||........|:|.||...||||||||:::.||::||||.:...    :||:|.....:.
Zfish    18 DDKIVGGYECQPNSQPWQASLNSGYHFCGGSLVSEYWVVSAAHCYKSRL----EVRLGEHNIVIN 78

  Fly   104 ---GQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGW 165
               .|.:..::|.|:|.:|::|||.|..|::|.:.:..|.....|.||...|  ||||...||||
Zfish    79 EGTEQFITSEKVIRNPNYDSWTIDSDIMLIKLSKPATLNKYVQPVALPNGCA--ADGTMCRVSGW 141

  Fly   166 GNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADG 230
            |||.|:...|..|:.:.:|.:|...|..:|.  |.|||.|.|||..|||||:||||||||:..:|
Zfish   142 GNTMSSTADSNKLQCLEIPILSDRDCKNSYP--GMITDTMFCAGYLEGGKDSCQGDSGGPVVCNG 204

  Fly   231 VLWGVVSWGYGCARPNYPGVYSRVSAVRDWIS 262
            .|.|:||||||||:.:.||||.:|.....||:
Zfish   205 ELQGIVSWGYGCAQKDNPGVYGKVCMFSQWIA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 96/222 (43%)
Tryp_SPc 42..264 CDD:238113 98/224 (44%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 96/222 (43%)
Tryp_SPc 21..238 CDD:238113 98/224 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3303
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3890
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm6438
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.