DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and LOC100498532

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:255 Identity:84/255 - (32%)
Similarity:129/255 - (50%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSY---HFCGGSLIAQGWVLTAAHCTE 84
            :|:.|::.|.......|.:||||........|:||..  :|   ::||||||:..|:::||||.:
 Frog     6 VLMFLAVAAAAPLDDDDDKIVGGYECTPHSQPWQVLF--TYNGGNWCGGSLISPRWIISAAHCYQ 68

  Fly    85 GSAILLS-------KVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQ 142
            ....|::       |.:.|:.      |.:.::..::|..:.....|.|..|::|.:.:..|  |
 Frog    69 PPKTLVALLGEHDLKKKEGTE------QHIQVEAAYKHFGYKDKAHDHDIMLVKLAKPAQYN--Q 125

  Fly   143 AFVGLPEQDADIADGTPVLVSGWGNTQSAQ-ETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRML 206
            ....:|...:...||...||||:||..... .....|:.:.||.||.:.|..:|...  |::.|.
 Frog   126 YVQPIPVARSCPTDGAKCLVSGFGNVLGYNVRYPDQLQCLEVPIVSDSSCKASYPRM--ISENMF 188

  Fly   207 CAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYG-CARPNYPGVYSRVSAVRDWISSVS 265
            |||..||||.:|.|||||||..:|.|:|.||||.. |...|.||||::|....|||.:::
 Frog   189 CAGFLEGGKGSCHGDSGGPLICNGELYGAVSWGGSYCISKNSPGVYAKVCNYLDWIKNIT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 78/231 (34%)
Tryp_SPc 42..264 CDD:238113 80/233 (34%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3316
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm9407
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.