DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and LOC100485189

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:246 Identity:97/246 - (39%)
Similarity:126/246 - (51%) Gaps:14/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQR-SYHFCGGSLIAQGWVLTAAHCTEG 85
            ||.|:..||..|:....| ||:||........|:..||.. ..|.|||.||.:.||||||||...
 Frog     3 ILFVSALLGTAVQARYYD-RIIGGTECRPNSQPWHCSLYYFDQHVCGGVLIDENWVLTAAHCQLS 66

  Fly    86 SAILLSKVRIGSSRTSV---GGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGL 147
            |.    :||:|....:|   ..|....:::..|..|:..|.|.|..||:|  .|...:......:
 Frog    67 SL----QVRLGEHNLAVYEGKEQFSYAEKMCPHSGFNPITFDNDIMLLKL--VSPVTINDYVQTI 125

  Fly   148 PEQDADIADGTPVLVSGWGNTQSAQET-SAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLP 211
            |.....:.||...||||||.|.|.:|| ...|:.|.|..|||..|..|:.. ..|||.|||||:.
 Frog   126 PLGCPTVGDGETCLVSGWGTTTSPEETFPDELQCVEVQTVSQDYCQGAFPT-DEITDNMLCAGVM 189

  Fly   212 EGGKDACQGDSGGPLAADGVLWGVVSWG-YGCARPNYPGVYSRVSAVRDWI 261
            |||||:|||||||||..:.::.|:.||| ..|...|.||:|:::.....||
 Frog   190 EGGKDSCQGDSGGPLVCNSMVHGITSWGNTPCGVANKPGIYTKICNYIAWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 88/225 (39%)
Tryp_SPc 42..264 CDD:238113 89/226 (39%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 89/226 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3316
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3758
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - mtm9407
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.