DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and gzma

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:232 Identity:85/232 - (36%)
Similarity:118/232 - (50%) Gaps:9/232 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQGWVLTAAHC-TEGSAILLSKVRIGSSRTSVGGQ 105
            |:.|:.|.....||...:......|||:||.|.|||||||| ...|.::|...::.|....  .|
 Frog    35 IIDGREAASHSRPYMAYIYSRTGSCGGTLIKQNWVLTAAHCVVNNSEVILGAHKVKSRENE--QQ 97

  Fly   106 LVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQS 170
            ...:.|...||.|:......|..||:::..:..|...:.:.||..|.|:..|:....:|||.|:.
 Frog    98 RFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFVSVLKLPTTDMDVKPGSSCSTAGWGVTKP 162

  Fly   171 AQET-SAVLRSVTVPKVSQTQCTEAYGNFGS-ITDRMLCAGLPEGGK---DACQGDSGGPLAADG 230
            ..:| |.|||.|.|..|.:..|.:.|..|.: |:..|||||.|:...   |||||||||||....
 Frog   163 NGKTPSDVLREVNVTVVDRGTCNKIYKKFKTEISTNMLCAGAPKKSDKKYDACQGDSGGPLICGK 227

  Fly   231 VLWGVVSWGYGCARPNYPGVYSRVSA-VRDWISSVSG 266
            ...|:||:|..|..|.|||:|:|::| ...||..|:|
 Frog   228 EFSGIVSFGKKCGDPKYPGIYTRLTARYLQWIRDVTG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 81/225 (36%)
Tryp_SPc 42..264 CDD:238113 83/228 (36%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 83/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.