DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and zgc:165423

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:243 Identity:96/243 - (39%)
Similarity:130/243 - (53%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LDGRIVGGQVANIKDIPYQVSLQRS-YHFCGGSLIAQGWVLTAAHCTEGS------AILLSKVRI 95
            |:.:||||..|:....|:|.||..| .||||||||:..|:|:||||...:      .:.|.  |.
Zfish    34 LNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPSNPNPSDYTVYLG--RQ 96

  Fly    96 GSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGT-- 158
            .....:.......:.:|..||.:...|.|.|.:||.|    :..||  |....:.....|||:  
Zfish    97 SQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMALLHL----SSPVT--FSNYIQPVCLAADGSTF 155

  Fly   159 ---PVLVSGWGNTQS--AQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDAC 218
               .:.::|||..:|  :..:..:|:.|.||.|....|...||...|||:.|:||||.:||||:|
Zfish   156 YNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSSITNNMMCAGLMQGGKDSC 220

  Fly   219 QGDSGGPLAADGV-LW---GVVSWGYGCARPNYPGVYSRVSAVRDWIS 262
            |||||||:..... .|   ||||:|.|||.|||||||:|||..::|||
Zfish   221 QGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWIS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 92/237 (39%)
Tryp_SPc 42..264 CDD:238113 95/239 (40%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 92/237 (39%)
Tryp_SPc 38..269 CDD:238113 95/239 (40%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.