DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and zgc:165423

DIOPT Version :10

Sequence 1:NP_523518.2 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001093620.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:411 Species:Danio rerio


Alignment Length:119 Identity:57/119 - (47%)
Similarity:75/119 - (63%) Gaps:11/119 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ADGT-----PVLVSGWGNTQS--AQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPE 212
            |||:     .:.::|||..:|  :..:..:|:.|.||.|....|...||...|||:.|:||||.:
Zfish    23 ADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLYGGGSSITNNMMCAGLMQ 87

  Fly   213 GGKDACQGDSGGPLAADGV-LW---GVVSWGYGCARPNYPGVYSRVSAVRDWIS 262
            ||||:||||||||:..... .|   ||||:|.|||.|||||||:|||..::|||
Zfish    88 GGKDSCQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWIS 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_523518.2 Tryp_SPc 42..264 CDD:238113 57/119 (48%)
zgc:165423NP_001093620.1 Tryp_SPc <2..142 CDD:238113 57/119 (48%)
Tryp_SPc 178..346 CDD:473915
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.