DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and si:dkey-78l4.7

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_003201098.1 Gene:si:dkey-78l4.7 / 100034654 ZFINID:ZDB-GENE-060503-176 Length:257 Species:Danio rerio


Alignment Length:261 Identity:83/261 - (31%)
Similarity:120/261 - (45%) Gaps:15/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSY-HFCGGSLIAQ 73
            ||..|:.|.:...|:.:|:..|.|       .||.|..|.....||.||||:.: |.|||.||::
Zfish     1 MAIIIISLLLLVSLVPHLTFSAHV-------GIVNGTEAKPHSRPYMVSLQKGFQHVCGGFLISE 58

  Fly    74 GWVLTAAHCTEGSAILLSKVRIGSSRT-SVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSA 137
            .:|||||||..|:.||.:.|...:.|. |.....:.:|..|.||.|.......|..||:|.:...
Zfish    59 KFVLTAAHCRMGNEILTAVVGAHNLRNRSEKSVRMKVKSYHLHPDFTVKPWRNDVMLLKLVKKVQ 123

  Fly   138 KNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSIT 202
            .|.....:.:.:|:.||...:...|:||.......:.|..|....|..::.|:|...:... .:.
Zfish   124 LNKNVKIISMSKQERDIKPDSACAVAGWEKLSFKGKVSTQLMEAGVKIMNNTECENKWKKI-YLP 187

  Fly   203 DRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYG--CARPNYPGVYSRVSAVRDWISSVS 265
            .:|:|. ...||  :|.|||||||..:....||.|:|..  |.....|.||.::|....||.|:.
Zfish   188 SQMICV-YGHGG--SCGGDSGGPLVCEDTAVGVTSFGDARVCNSRKRPEVYMKISEFLPWIDSII 249

  Fly   266 G 266
            |
Zfish   250 G 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 71/223 (32%)
Tryp_SPc 42..264 CDD:238113 73/225 (32%)
si:dkey-78l4.7XP_003201098.1 Tryp_SPc 26..248 CDD:238113 73/225 (32%)
Tryp_SPc 26..245 CDD:214473 71/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.