DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and zgc:163079

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:278 Identity:98/278 - (35%)
Similarity:138/278 - (49%) Gaps:53/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGGILLVNLS--LGAT--VRRPRLDGRIVGGQVANIKDIPYQVSLQ---RSYHFCGGSLIAQGWV 76
            :.|.:|:|::  ||.:  ..|..|:.:|:||..|.....|:|.|:.   ....:||||||.:|||
Zfish     9 VAGAILLNIAGCLGQSDVCGRAPLNTKIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWV 73

  Fly    77 LTAAH------CTEGSAILLSKVRIGS-----SRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLL 130
            ||.|.      .::....|..:.:.||     |||        :.::.:||.::  ::|.:.:||
Zfish    74 LTTAKVFALMPASDIVVYLGRQTQNGSNPYEISRT--------VTKIIKHPNYN--SLDSNLALL 128

  Fly   131 EL------EEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWG--NTQSAQE---TSAVLRSVTVP 184
            :|      .:| .|.|..|..|     :...|||...|:|||  |..:..|   ...||:.|..|
Zfish   129 KLSSPVTFSDY-IKPVCLAAAG-----SVFVDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAP 187

  Fly   185 KVSQTQCTEAYGNFGSITDRMLCAG-LPEGGKDACQGDSGGPLA-ADGVLW---GVVSWGYGCAR 244
            .|:..:|..|||  |.||:::|||| |.|.||..|.||.||||. ..|.:|   |||..|| |..
Zfish   188 IVNNFECNAAYG--GIITNKLLCAGYLNEDGKAPCAGDVGGPLVIKQGAIWIQSGVVVSGY-CGL 249

  Fly   245 PNYPGVYSRVSAVRDWIS 262
            |.||.:|.|||...||||
Zfish   250 PGYPTIYVRVSEYEDWIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 88/249 (35%)
Tryp_SPc 42..264 CDD:238113 91/251 (36%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 88/249 (35%)
Tryp_SPc 36..267 CDD:238113 89/249 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.