DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Try29F and gzm3.4

DIOPT Version :9

Sequence 1:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001108167.1 Gene:gzm3.4 / 100001210 ZFINID:ZDB-GENE-070912-136 Length:251 Species:Danio rerio


Alignment Length:249 Identity:77/249 - (30%)
Similarity:125/249 - (50%) Gaps:19/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTEG 85
            |:|::.|:   ::...::..||||:...:...||..||| :..|.|||.||.:.:|||:|||.:.
Zfish     8 IILISYSV---IKTGGMESGIVGGREVKLHSRPYMASLQVQRKHNCGGILIKEDYVLTSAHCWKD 69

  Fly    86 SAILLSKVRIGS---SRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGL 147
            :..|  :|.:|:   |:.....|::.:::..:||.:......||..||:|:..:..|.......|
Zfish    70 TTNL--EVVLGAHNISQRENSQQIIQVQKYIKHPNYQKKNHSFDIMLLKLKTKAVLNHFVNITNL 132

  Fly   148 PEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCT---EAYGNFGSITDRMLCAG 209
            |:.:..|.......::|||..:..:..|.|||.|.:...|.:.|.   :.|.|    :..|:|..
Zfish   133 PKHEPSILAPVECSIAGWGMQRPGEGASNVLREVNLQLESNSYCKSKWQVYFN----SKNMVCTA 193

  Fly   210 LPEGGKDACQGDSGGPLAADGVLWGVVSWGY--GCARPNYPGVYSRVSAVRDWI 261
             .:|.|..||||||.||..:..|:|:.::.|  .|....||.||.:|||...||
Zfish   194 -SDGKKAFCQGDSGSPLFCNSELYGMAAYTYPNNCTFKEYPEVYMKVSAFLPWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 72/228 (32%)
Tryp_SPc 42..264 CDD:238113 74/229 (32%)
gzm3.4NP_001108167.1 Tryp_SPc 25..249 CDD:238113 74/229 (32%)
Tryp_SPc 25..246 CDD:214473 72/227 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.