DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17906 and AT1G10660

DIOPT Version :9

Sequence 1:NP_609266.1 Gene:CG17906 / 34224 FlyBaseID:FBgn0032086 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_172536.1 Gene:AT1G10660 / 837609 AraportID:AT1G10660 Length:320 Species:Arabidopsis thaliana


Alignment Length:286 Identity:56/286 - (19%)
Similarity:108/286 - (37%) Gaps:95/286 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RSQWQNGERNLIWVLYR--------------WLLA----AFFA--AGVIGSMMQDFNGGRWFIYL 78
            |.:.:..:|.|...|::              ||||    :|.|  ..:|.::::|  |...|.:.
plant    41 RRRQRESQRELPGTLFQDEAWTTCFKRIHPLWLLAFRVFSFVAMLTLLISNVVRD--GAGIFYFY 103

  Fly    79 TDWGFTLCLFTCTYGAVIATIY---YFN-------QSYFAPGHCALKIY---------------- 117
            |.|.|||......|.:|: ::|   .:|       :||.:.|......|                
plant   104 TQWTFTLVTLYFGYASVL-SVYGCCIYNKEASGNMESYTSIGDTEQGTYRPPIALDGEGNTSKAS 167

  Fly   118 --------------WISHYTTSVL-------SMLITTVFWAALSLTMPEVAG---ELYNLWCHAF 158
                          |:  |...:|       .:|...||||   :..|...|   ...::..|:.
plant   168 NRPSEAPARKTAGFWV--YIFQILFQTCAGAVVLTDIVFWA---IIYPFTKGYKLSFLDVCMHSL 227

  Fly   159 NSICMVFDCFM--VAYP-NRLMHFVYPFSVVLI---FLMHSLIYYWAGGTDIDGNRFIYFALDWA 217
            |::.::.|..:  :.:| .|:.:||. :|.:.:   :::|::...|          :.|..||.:
plant   228 NAVFLLGDTSLNSLRFPLFRIAYFVL-WSCIFVAYQWIIHAVKNLW----------WPYQFLDLS 281

  Fly   218 RPGLAIGFVCASLALICCFSLVAFGI 243
            .|...:.::..::..|.||::.|..|
plant   282 SPYAPLWYLGVAVMHIPCFAVFALVI 307



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.