DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17906 and AT2G47115

DIOPT Version :9

Sequence 1:NP_609266.1 Gene:CG17906 / 34224 FlyBaseID:FBgn0032086 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_566096.2 Gene:AT2G47115 / 819324 AraportID:AT2G47115 Length:300 Species:Arabidopsis thaliana


Alignment Length:253 Identity:50/253 - (19%)
Similarity:95/253 - (37%) Gaps:83/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WLL----------AAFFAAGVIGSMMQDFNGGRW----FIYLTDWGFTLCLFTCTYGAVIATIY- 100
            |||          ||..|..||          :|    |:|.|:|.|.|.:.....| ::|::| 
plant    71 WLLFTRSTSFLSMAALLAWDVI----------KWDASIFVYYTEWTFMLVIIYFAMG-IVASVYG 124

  Fly   101 -----------------------YFNQSYFAPGHCALKIYWISHYTTSVLSMLIT-TVFWAALSL 141
                                   .|.:.....| |.::    :.:.||..::::| .|||..:  
plant   125 CLIHLKELTLETDEDVVVEKVGDEFRRRLEVCG-CFMQ----TIFQTSAGAVVLTDIVFWLVI-- 182

  Fly   142 TMPEVAGELYNL-----WCHAFNSICMVFDCFMVAYP---NRLMHFVYPFSVVLIF--LMHSLIY 196
             :|.::...:.|     ..|..|:..::.:..:.:.|   .|:.:||....:.:||  ::|:..:
plant   183 -VPFLSTTRFGLNTLTICMHTANAGFLLLETLLNSLPFPWFRMGYFVLWSCLYVIFQWIIHACGF 246

  Fly   197 YWAGGTDIDGNRFIYFALDWARPGLAIGFVCASLALICCFSLVAFGIYRLRMSVYNCC 254
            .|          :.|..|:..:|...|.::|.::..|.|     :|.|...:...|.|
plant   247 TW----------WPYPFLELDKPWAPIWYLCMAIVHIPC-----YGAYAAIVKAKNSC 289



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.