DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17906 and CG4480

DIOPT Version :9

Sequence 1:NP_609266.1 Gene:CG17906 / 34224 FlyBaseID:FBgn0032086 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001188814.1 Gene:CG4480 / 34864 FlyBaseID:FBgn0032553 Length:272 Species:Drosophila melanogaster


Alignment Length:249 Identity:92/249 - (36%)
Similarity:145/249 - (58%) Gaps:5/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKEEFQRSKFSLHHEDPGVFCRSQWQNGERNLIWVLYRWLLAAFFAAGVIGSMMQDFNGGRWFIY 77
            |::|.:..:..|||..|..|.|||||:|.::.|::.|||.|..||.|||:|.:.:.:|.|.:||:
  Fly    23 LRDELRFRRLGLHHHSPTDFLRSQWQSGPKSSIFLAYRWALGGFFGAGVVGCISEYYNHGNFFIF 87

  Fly    78 LTDWGFTLCLFTCTYGAVIATIYYFNQSYFAPGHCALKIYWISHYTTSVLSMLITTVFWAAL--- 139
            ||:|||.||..|...||::.|||::....:.|....:|:||..::|...|:.||...:|.|:   
  Fly    88 LTNWGFVLCGVTSIAGAILVTIYHYKPETWVPPSGWIKVYWACYWTNITLACLIAFAYWTAIYPK 152

  Fly   140 --SLTMPEVAGELYNLWCHAFNSICMVFDCFMVAYPNRLMHFVYPFSVVLIFLMHSLIYYWAGGT 202
              .||.|....:|||:|.|....|....|.|:||.|.||:|||||.:.:..:.:.::::|..||.
  Fly   153 DRVLTNPTRVSDLYNIWTHLLPPIFFTIDNFLVAQPARLLHFVYPLAFLHTYGIFAILFYALGGR 217

  Fly   203 DIDGNRFIYFALDWARPGLAIGFVCASLALICCFSLVAFGIYRLRMSVYNCCGK 256
            ::||..:||..|::|||.:.:..|.....::...|.:.:|:||||..:....||
  Fly   218 NLDGKHYIYPFLNFARPKIVLKTVTYLSIVLVSLSSLEYGVYRLRNFIARKLGK 271



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450783
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 1 1.000 - - FOG0009967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.