DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17906 and CG43778

DIOPT Version :9

Sequence 1:NP_609266.1 Gene:CG17906 / 34224 FlyBaseID:FBgn0032086 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001369129.1 Gene:CG43778 / 34738 FlyBaseID:FBgn0264308 Length:1003 Species:Drosophila melanogaster


Alignment Length:299 Identity:77/299 - (25%)
Similarity:129/299 - (43%) Gaps:63/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NAESC--------------CQPLKEEFQRSKFSLHHEDPGVFCRSQWQ-NGERNLIWVLYRWLLA 54
            ||.||              |.|   ||.......|:     |...||| |.:..::::.|||:.|
  Fly   503 NAGSCLGNQRMMVSKLWNSCFP---EFTPDHVHRHN-----FYLCQWQRNTQVRIVYLFYRWITA 559

  Fly    55 AFFAAGVIGSMMQ--------DFNGGRWFIYLTDWGFTLCLFTCTYGAVIAT---------IYYF 102
            ....|.::.|::.        :.:..:|:||||.||...|.......|.|.|         ....
  Fly   560 ITCLAALVCSLLDIGRTDEHFEHHYAKWWIYLTHWGLLFCTVQAWLAAWIVTQGMMVEREDFEIV 624

  Fly   103 NQSYFAPGHCALKIYWISHYTTSVLSMLITTVFWAALSLTMPEVAG-ELYNLWCHAFNSICMVFD 166
            .|:..:..|   .:||:.:...:|.:.::|..:|  |.:..||:.. :..|:..|..|:|.|:.|
  Fly   625 RQAKKSRLH---HLYWVLYTCATVYAFIVTMCYW--LLVHNPEIHKIDALNIMVHVLNTIIMLID 684

  Fly   167 CFMVAYPNRLMHFVYPFSVVLIFLMHSLIYYWAGGTDIDGNRFIYFALDWARPGLAIGFVCASLA 231
            ..:|.:|.::.|..:...:.|.:.:.:.||:.|||||......||..:||.:||.||  :..:.|
  Fly   685 LAIVGHPIKMSHAYFTTGIGLAYAIFTGIYFLAGGTDRKNQTAIYPMMDWTKPGKAI--IVTACA 747

  Fly   232 LI-------CCFSLVAFGIYRLRMSVYN--CC-GKRKEE 260
            :|       ||:.|     ||.|:.::.  |. |:|..:
  Fly   748 IIFTFFVHFCCYLL-----YRGRVWLFTKLCIRGRRNRD 781



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.