DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17906 and rost

DIOPT Version :9

Sequence 1:NP_609266.1 Gene:CG17906 / 34224 FlyBaseID:FBgn0032086 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001260274.1 Gene:rost / 34222 FlyBaseID:FBgn0011705 Length:275 Species:Drosophila melanogaster


Alignment Length:258 Identity:89/258 - (34%)
Similarity:138/258 - (53%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CQPLKEEFQRSKFSLHHEDPGVFCRSQWQNGERNLIWVLYRWLLAAFFAAGVIGSMMQDFNGGRW 74
            |:...:|.||:.|...:....:|.|||||..|.|.|::||||:.|.||....|..::..|..|::
  Fly     8 CKSFNKELQRANFGFAYNRVHLFYRSQWQKDEINTIYLLYRWIWALFFLGVYIMCVIVQFCDGKF 72

  Fly    75 FIYLTDWGFTLCLFTCTYGAVIATIYYFN---------QSYFAPGHCA-----LKIYWISHYTTS 125
            |||:|:|||.||..|....||..|.::|:         :|    ||.|     |||||..:..|.
  Fly    73 FIYMTNWGFGLCTITMLISAVQVTCWHFDVRSTRSLVQES----GHKAETSRGLKIYWWLYNMTL 133

  Fly   126 VLSMLITTVFWAAL------SLTMPEVAGELYNLWCHAFNSICMVFDCFMVAYPNRLMHFVYPFS 184
            .|:::|:||:|..|      .:..|.:     ::..|..||:.|:.|..::|:|.|::|.||..|
  Fly   134 SLALIISTVYWVFLHGKMNKPMRFPAI-----SIITHGMNSVMMLIDFLVIAFPLRILHMVYGMS 193

  Fly   185 VVLIFLMHSLIYYWAGGTDIDGNRFIYFALDWARPGLAIGFVCASLALICCFSLVAFGIYRLR 247
            :.:.|.:.:|||:..||||..||.::|..|||..|...:........||.|:.::.||:|:|:
  Fly   194 LAIFFFLFTLIYHLCGGTDEFGNHYVYPILDWNNPNRCMVTFVGIFLLIMCYWVLLFGLYKLK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17906NP_609266.1 None
rostNP_001260274.1 Far-17a_AIG1 52..254 CDD:147085 69/210 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450786
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 1 1.000 - - FOG0009967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.