DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9555 and AT5G62960

DIOPT Version :9

Sequence 1:NP_001285770.1 Gene:CG9555 / 34223 FlyBaseID:FBgn0032085 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_201101.2 Gene:AT5G62960 / 836416 AraportID:AT5G62960 Length:347 Species:Arabidopsis thaliana


Alignment Length:270 Identity:57/270 - (21%)
Similarity:95/270 - (35%) Gaps:99/270 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CCLPLK-------------EEFQRSKFSLHHDDPGD-------FCRSQWQKGDRNI--IWLL-YR 50
            ||:.:.             |.|:|.:..:...|.|:       :....|:...|||  .||| :|
plant    43 CCIWMAIATVITAFLIFKYEGFRRKRSDVGEVDGGEKEWSGNVYEDETWRPCLRNIHPAWLLAFR 107

  Fly    51 WILAAFFAAGVIGSMVETFNGGRWFIYLTDWGFSLCFYCCTYGAIIATIYF-------------- 101
              :.|||...|:..::...:|...|.|.|.|         |:|.|  |:||              
plant   108 --VVAFFVLLVMLIVIGLVDGPTIFFYYTQW---------TFGLI--TLYFGLGSLLSLHGCYQY 159

  Fly   102 ----------------------------IKPSYFA---PGSWALKIYWISHYTTVVLAMMITLVF 135
                                        |:.|.::   .|.|.. ::.|.........::...||
plant   160 NKRAAGDRVDSIEAIDSERARSKGADNTIQQSQYSSNPAGFWGY-VFQIIFQMNAGAVLLTDCVF 223

  Fly   136 WAALYPSMP----GMGAELYNLWAHAFNSICLVFDCFM--VAFPT-RIMHFVYPFTAGITYGVF- 192
            |..:.|.:.    .:...:.|:  |:.|:|.|:.|..:  ::||. ||.:|   |...|.|.:| 
plant   224 WFIIVPFLEIHDYSLNVLVINM--HSLNAIFLLGDAALNSLSFPCFRIAYF---FFWTIAYVIFQ 283

  Fly   193 ----SLIYFW 198
                ||::.|
plant   284 WALHSLVHIW 293



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.