DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9555 and AT3G27770

DIOPT Version :9

Sequence 1:NP_001285770.1 Gene:CG9555 / 34223 FlyBaseID:FBgn0032085 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_566825.1 Gene:AT3G27770 / 822398 AraportID:AT3G27770 Length:315 Species:Arabidopsis thaliana


Alignment Length:299 Identity:62/299 - (20%)
Similarity:100/299 - (33%) Gaps:101/299 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKSQEPCCLPLKEEFQRSKFSLHHDDPGDFCRSQWQKGDRNIIWLL-YRWILAAFFAAGVIGSMV 66
            |....||       |:|    :|   ||               ||| :|.:...|..|..|....
plant    61 DDVWRPC-------FER----IH---PG---------------WLLGFRVLGFCFLLANNIARFA 96

  Fly    67 ETFNGGRWFIYLTDWGFSL------------CFYCCTY------GAIIATIYFIKPSYF------ 107
            .  .|.|.:.|.|.|.|:|            .:.|..|      |.|...:.....:.|      
plant    97 N--RGWRIYYYYTQWTFTLIAIYFGMGSLLSIYGCLQYKKQGNTGLIADQVGIDAENGFRSPLID 159

  Fly   108 -----------APGSWALKIYWISHYTTVV------LAMMITLVFWAALYPSMPGMGAEL----Y 151
                       ..||.|||.|  .|...::      .|::...::|..::|.:.....|:    .
plant   160 GDNMVSFEKRKTSGSEALKSY--VHLFQIIYQMGAGAAVLTDSIYWTVIFPFLSLQDYEMSFMTV 222

  Fly   152 NLWAHAFNSICLVFDCFM--VAFPT-RIMHFVYPFTAGITYGVFSLIYFWAGGMDPMGNRFIYFI 213
            ||  |..|.:.|:.|.|:  :.||. |..:|:      :..|.| :::.|...|        :..
plant   223 NL--HTSNLVLLLIDTFLNRLKFPLFRFSYFI------LWTGCF-VLFQWILHM--------FIS 270

  Fly   214 LDWERPGLAIGTVCGCV--VLVSCFCVLVFGFYRLRISI 250
            :.|..|.|.:......|  :||:...:..:|.:.|.:.|
plant   271 VGWPYPFLNLSLDMAPVWYLLVALLHLPSYGLFALIVKI 309



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.