DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9555 and CG43778

DIOPT Version :9

Sequence 1:NP_001285770.1 Gene:CG9555 / 34223 FlyBaseID:FBgn0032085 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001369129.1 Gene:CG43778 / 34738 FlyBaseID:FBgn0264308 Length:1003 Species:Drosophila melanogaster


Alignment Length:262 Identity:73/262 - (27%)
Similarity:122/262 - (46%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CLPLKEEFQRSKFSLHHDDPGDFCRSQWQKGDR-NIIWLLYRWILAAFFAAGVIGSMVE------ 67
            |.|        :|:..|....:|...|||:..: .|::|.||||.|....|.::.|:::      
  Fly   522 CFP--------EFTPDHVHRHNFYLCQWQRNTQVRIVYLFYRWITAITCLAALVCSLLDIGRTDE 578

  Fly    68 --TFNGGRWFIYLTDWGFSLCFYCCTYGAIIATI-YFIKPSYF-----APGSWALKIYWISHYTT 124
              ..:..:|:||||.||...|.......|.|.|. ..::...|     |..|....:||:.:...
  Fly   579 HFEHHYAKWWIYLTHWGLLFCTVQAWLAAWIVTQGMMVEREDFEIVRQAKKSRLHHLYWVLYTCA 643

  Fly   125 VVLAMMITLVFWAALY-PSMPGMGAELYNLWAHAFNSICLVFDCFMVAFPTRIMHFVYPFTAGIT 188
            .|.|.::|:.:|..:: |.:..:.|  .|:..|..|:|.::.|..:|..|.::.|..:....|:.
  Fly   644 TVYAFIVTMCYWLLVHNPEIHKIDA--LNIMVHVLNTIIMLIDLAIVGHPIKMSHAYFTTGIGLA 706

  Fly   189 YGVFSLIYFWAGGMDPMGNRFIYFILDWERPGLAIGTVCGCVVLVSCF----CVLVFGFYRLRIS 249
            |.:|:.|||.|||.|......||.::||.:||.|| .|..|.::.:.|    |.|:   ||.|:.
  Fly   707 YAIFTGIYFLAGGTDRKNQTAIYPMMDWTKPGKAI-IVTACAIIFTFFVHFCCYLL---YRGRVW 767

  Fly   250 IY 251
            ::
  Fly   768 LF 769



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.