DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9555 and CG13101

DIOPT Version :9

Sequence 1:NP_001285770.1 Gene:CG9555 / 34223 FlyBaseID:FBgn0032085 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_609264.1 Gene:CG13101 / 34221 FlyBaseID:FBgn0032084 Length:318 Species:Drosophila melanogaster


Alignment Length:277 Identity:101/277 - (36%)
Similarity:154/277 - (55%) Gaps:22/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PLKEEFQRSKFSLHHDDPGDFCRSQWQKGDRNIIWLLYRWILAAFFAAGVIGSM-VETFNG-GRW 74
            |:|:||||......||.|.||.:||||...:::.:|.|||.:|.||...||.|| .||.:. ..|
  Fly    13 PVKKEFQRKSCGFDHDTPDDFVKSQWQSCTKSMAYLFYRWFMAMFFVVVVIISMWPETDDATSYW 77

  Fly    75 --FIYLTDWGFSLCFYCCTYGAIIATIYFIKP----------SYFAPGSWALKIYWISHYTTVVL 127
              |||:|:||..:|......|||:.||:...|          |||:    ..::||..|..::||
  Fly    78 LYFIYMTNWGIWMCMLTNVLGAILVTIWHYHPEYADKLLNMKSYFS----YFRLYWGMHIISLVL 138

  Fly   128 AMMITLVFWAALYPSMPGMGAELYNLWAHAFNSICLVFDCFMVAFPTRIMHFVYPFTAGITYGVF 192
            :::||:::|:.||.:... ..:..|:..|||||||:..|.::||.|.|::|...|...|:.:.:|
  Fly   139 SIVITIIYWSILYDANES-ALDATNVLTHAFNSICMFIDLWIVAHPLRLLHIFLPVLFGVVFAIF 202

  Fly   193 SLIYFWAGGMDPMGNRFIYFILDWERPGLAIGTVCGCVVLVSCFCVLVFGFYRLRISIYESCSKK 257
            |.||...||::..|..:||:::||.:|..|..||.|.::|..|..||:|.|::||:.::..|...
  Fly   203 SYIYHLCGGINKKGKPYIYYVIDWSKPQNAFTTVVGVLLLSCCIYVLLFAFFKLRLFLHRRCRNA 267

  Fly   258 PDEIPATTASPKEPAQT 274
            ...:|   .|.|...||
  Fly   268 NFVLP---TSAKSNGQT 281



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450785
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 1 1.000 - - FOG0009967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.