DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rost and AT1G70505

DIOPT Version :9

Sequence 1:NP_001260274.1 Gene:rost / 34222 FlyBaseID:FBgn0011705 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_683487.4 Gene:AT1G70505 / 843387 AraportID:AT1G70505 Length:358 Species:Arabidopsis thaliana


Alignment Length:273 Identity:57/273 - (20%)
Similarity:95/273 - (34%) Gaps:91/273 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 WIWALFFLGVYIMCVIVQ---FCDGK-FFIYMTNWGFGLCTITMLISAVQVTCWHF---DVRSTR 106
            |:......|..::..::.   ..||. .||:.|.|.|.|.||...:.:: |:.:.|   |....|
plant   104 WLLGFRVFGFVVLLGLISGNAIADGTGIFIFYTQWTFTLVTIYFGLGSL-VSIYRFRSPDNGENR 167

  Fly   107 -SLVQE--------------------SGHKAE--------TSRGLKIYWWLYNMTLSLALIISTV 142
             |:|.|                    |||..|        |:.|. |:..|:.......|:...|
plant   168 VSIVDEEQGTYRPPGNAENSNVFKSSSGHDRENMSTRQVATTLGY-IHQILFQTCAGAVLLTDGV 231

  Fly   143 YWVFLHGKMNKPMRFPAISIITHGMNSVMMLIDFLVIAFPLRILHMVYGMSLAIFFFLFTLIYHL 207
            :|..:         :|.::  ....|     :||.::     |:|.|..:.|....||.:|.:.|
plant   232 FWFII---------YPFLT--AKDFN-----LDFFIV-----IMHSVNAIFLLGETFLNSLGFIL 275

  Fly   208 CGGTDEFGNHYVYPILDWNNPNRCM-VTFVGI----FLLIMC--------------YWVLLF--- 250
            ||    ...|.....:|.:    |: :..|.:    |::|:|              .|.:.|   
plant   276 CG----MDRHIRAISMDCS----CLCLLLVALPILGFVIILCSFMVCGCWVDAHTMLWNICFDRE 332

  Fly   251 --GLYKLKRMFNR 261
              .|..||.:..|
plant   333 VEALVALKMLLRR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rostNP_001260274.1 Far-17a_AIG1 52..254 CDD:147085 53/261 (20%)
AT1G70505NP_683487.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.