DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rost and AT1G10660

DIOPT Version :9

Sequence 1:NP_001260274.1 Gene:rost / 34222 FlyBaseID:FBgn0011705 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_172536.1 Gene:AT1G10660 / 837609 AraportID:AT1G10660 Length:320 Species:Arabidopsis thaliana


Alignment Length:279 Identity:51/279 - (18%)
Similarity:102/279 - (36%) Gaps:74/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LFYRSQWQK--DEINTIYLLYRWIWALFFLGVYIMCVIVQFCDGKFFIYMTNWGFGLCTITMLIS 91
            ||....|..  ..|:.::||...:::...:...::..:|:...|.|:.| |.|.|.|.|:     
plant    55 LFQDEAWTTCFKRIHPLWLLAFRVFSFVAMLTLLISNVVRDGAGIFYFY-TQWTFTLVTL----- 113

  Fly    92 AVQVTCWHFDVRSTRSLVQESGHKAETSRGLKIY------------------------------- 125
                   :|...|..|:.....:..|.|..::.|                               
plant   114 -------YFGYASVLSVYGCCIYNKEASGNMESYTSIGDTEQGTYRPPIALDGEGNTSKASNRPS 171

  Fly   126 ---------WWLY-----NMTLSLALIIS-TVYWVFLHGKMNKPMRFPAISIITHGMNSVMMLID 175
                     :|:|     ..|.:.|:::: .|:|..:: ...|..:...:.:..|.:|:|.:|.|
plant   172 EAPARKTAGFWVYIFQILFQTCAGAVVLTDIVFWAIIY-PFTKGYKLSFLDVCMHSLNAVFLLGD 235

  Fly   176 FLV--IAFPLRILHMVYGMSLAIFFFLFTLIYHLCGGTDEFGNHYVYPILDWNNPNRCMVTFVGI 238
            ..:  :.|||  ..:.|.:..:..|..:..|.|.....     .:.|..||.::| ...:.::|:
plant   236 TSLNSLRFPL--FRIAYFVLWSCIFVAYQWIIHAVKNL-----WWPYQFLDLSSP-YAPLWYLGV 292

  Fly   239 FLL-IMCYWVLLFGLYKLK 256
            .:: |.|:.|... :.|||
plant   293 AVMHIPCFAVFAL-VIKLK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rostNP_001260274.1 Far-17a_AIG1 52..254 CDD:147085 42/250 (17%)
AT1G10660NP_172536.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.