DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rost and AT3G27770

DIOPT Version :9

Sequence 1:NP_001260274.1 Gene:rost / 34222 FlyBaseID:FBgn0011705 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_566825.1 Gene:AT3G27770 / 822398 AraportID:AT3G27770 Length:315 Species:Arabidopsis thaliana


Alignment Length:262 Identity:56/262 - (21%)
Similarity:87/262 - (33%) Gaps:86/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 WIWALFFLGVYIMCV--IVQFCD--GKFFIYMTNWGFGLCTITM----LISAVQVTCWHFDVRST 105
            |:.....||...:..  |.:|.:  .:.:.|.|.|.|.|..|..    |:|.  ..|..:..:..
plant    75 WLLGFRVLGFCFLLANNIARFANRGWRIYYYYTQWTFTLIAIYFGMGSLLSI--YGCLQYKKQGN 137

  Fly   106 RSLV-------QESG----------------HKAETSRGLKIYWWL----YNMTLSLALIISTVY 143
            ..|:       .|:|                .|...|..||.|..|    |.|....|::..::|
plant   138 TGLIADQVGIDAENGFRSPLIDGDNMVSFEKRKTSGSEALKSYVHLFQIIYQMGAGAAVLTDSIY 202

  Fly   144 WVFLHGKMNKPMRFPAIS----------IITHGMNSVMMLIDFLV--IAFPLRILHMVYGMSLAI 196
            |..:         ||.:|          :..|..|.|::|||..:  :.|||  ....|.:....
plant   203 WTVI---------FPFLSLQDYEMSFMTVNLHTSNLVLLLIDTFLNRLKFPL--FRFSYFILWTG 256

  Fly   197 FFFLFTLIYHLCGGTDEFGNHYVYPILDWNNPNRCMVTFVGIFLLIMCYWVLL--------FGLY 253
            .|.||..|.|:            :..:.|..|      |:.:.|.:...|.||        :||:
plant   257 CFVLFQWILHM------------FISVGWPYP------FLNLSLDMAPVWYLLVALLHLPSYGLF 303

  Fly   254 KL 255
            .|
plant   304 AL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rostNP_001260274.1 Far-17a_AIG1 52..254 CDD:147085 54/256 (21%)
AT3G27770NP_566825.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.