DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rost and AT2G47115

DIOPT Version :9

Sequence 1:NP_001260274.1 Gene:rost / 34222 FlyBaseID:FBgn0011705 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_566096.2 Gene:AT2G47115 / 819324 AraportID:AT2G47115 Length:300 Species:Arabidopsis thaliana


Alignment Length:252 Identity:55/252 - (21%)
Similarity:102/252 - (40%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WALF-----FLGVYIMCV--IVQFCDGKFFIYMTNWGFGLCTITM---LISAVQVTCWHFDVRST 105
            |.||     ||.:..:..  :::: |...|:|.|.|.|.|..|..   ::::|.....|....:.
plant    71 WLLFTRSTSFLSMAALLAWDVIKW-DASIFVYYTEWTFMLVIIYFAMGIVASVYGCLIHLKELTL 134

  Fly   106 RS----LVQESGHKAETSRGLKI----YWWLYNMTLSLALIISTVYWV----FLHGKMNKPMRF- 157
            .:    :|::.|.  |..|.|::    ...::..:....::...|:|:    ||     ...|| 
plant   135 ETDEDVVVEKVGD--EFRRRLEVCGCFMQTIFQTSAGAVVLTDIVFWLVIVPFL-----STTRFG 192

  Fly   158 -PAISIITHGMNSVMMLIDFLVIAFPLRILHMVYGMSLAIFFFLFTLIYHLCGGTDEFGNHYVYP 221
             ..::|..|..|:..:|::.|:.:.|.....|.|.:..:..:.:|..|.|.||.|     .:.||
plant   193 LNTLTICMHTANAGFLLLETLLNSLPFPWFRMGYFVLWSCLYVIFQWIIHACGFT-----WWPYP 252

  Fly   222 ILDWNNP-----NRCMVTFVGIFLLIMCYWVLLFGLY-KLKRMFNRAFSVVWSPHAV 272
            .|:.:.|     ..||.     .:.|.||     |.| .:.:..|..|..:: |:|:
plant   253 FLELDKPWAPIWYLCMA-----IVHIPCY-----GAYAAIVKAKNSCFPYLF-PNAL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rostNP_001260274.1 Far-17a_AIG1 52..254 CDD:147085 50/231 (22%)
AT2G47115NP_566096.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.