DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rost and CG43778

DIOPT Version :9

Sequence 1:NP_001260274.1 Gene:rost / 34222 FlyBaseID:FBgn0011705 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001369129.1 Gene:CG43778 / 34738 FlyBaseID:FBgn0264308 Length:1003 Species:Drosophila melanogaster


Alignment Length:288 Identity:79/288 - (27%)
Similarity:131/288 - (45%) Gaps:60/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DFCKSFNKELQRANFGFAYNRV--------------------HLFYRSQWQKD-EINTIYLLYRW 49
            |.|:.||:....|.......|:                    |.||..|||:: ::..:||.|||
  Fly   492 DSCEGFNQFATNAGSCLGNQRMMVSKLWNSCFPEFTPDHVHRHNFYLCQWQRNTQVRIVYLFYRW 556

  Fly    50 IWALFFLGVYIMCVIVQFCD---------------GKFFIYMTNWGFGLCTITMLISAVQVTCWH 99
            |.|       |.|:....|.               .|::||:|:||...||:...::|..||...
  Fly   557 ITA-------ITCLAALVCSLLDIGRTDEHFEHHYAKWWIYLTHWGLLFCTVQAWLAAWIVTQGM 614

  Fly   100 FDVRSTRSLVQESGHKAETSRGLKIYWWLYNMTLSLALIISTVYWVFLHG-KMNKPMRFPAISII 163
            ...|....:|::    |:.||...:||.||......|.|::..||:.:|. :::|   ..|::|:
  Fly   615 MVEREDFEIVRQ----AKKSRLHHLYWVLYTCATVYAFIVTMCYWLLVHNPEIHK---IDALNIM 672

  Fly   164 THGMNSVMMLIDFLVIAFPLRILHMVYGMSLAIFFFLFTLIYHLCGGTDEFGNHYVYPILDWNNP 228
            .|.:|:::||||..::..|:::.|..:...:.:.:.:||.||.|.||||......:||::||..|
  Fly   673 VHVLNTIIMLIDLAIVGHPIKMSHAYFTTGIGLAYAIFTGIYFLAGGTDRKNQTAIYPMMDWTKP 737

  Fly   229 NR------CMVTFVGIFLLIMCYWVLLF 250
            .:      |.:.|. .|:...||  ||:
  Fly   738 GKAIIVTACAIIFT-FFVHFCCY--LLY 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rostNP_001260274.1 Far-17a_AIG1 52..254 CDD:147085 61/221 (28%)
CG43778NP_001369129.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.