DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rost and CG9555

DIOPT Version :9

Sequence 1:NP_001260274.1 Gene:rost / 34222 FlyBaseID:FBgn0011705 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001285770.1 Gene:CG9555 / 34223 FlyBaseID:FBgn0032085 Length:275 Species:Drosophila melanogaster


Alignment Length:249 Identity:91/249 - (36%)
Similarity:135/249 - (54%) Gaps:11/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CKSFNKELQRANFGFAYNRVHLFYRSQWQKDEINTIYLLYRWIWALFFLGVYIMCVIVQFCDGKF 72
            |....:|.||:.|...::....|.||||||.:.|.|:||||||.|.||....|..::..|..|::
  Fly    10 CLPLKEEFQRSKFSLHHDDPGDFCRSQWQKGDRNIIWLLYRWILAAFFAAGVIGSMVETFNGGRW 74

  Fly    73 FIYMTNWGFGLCTITMLISAVQVTCWHFDVRSTRSLVQESGHKAETSRGLKIYWWLYNMTLSLAL 137
            |||:|:|||.||.......|:..|.:..          :..:.|..|..|||||..:..|:.||:
  Fly    75 FIYLTDWGFSLCFYCCTYGAIIATIYFI----------KPSYFAPGSWALKIYWISHYTTVVLAM 129

  Fly   138 IISTVYWVFLHGKMNKPMRFPAISIITHGMNSVMMLIDFLVIAFPLRILHMVYGMSLAIFFFLFT 202
            :|:.|:|..|:..| ..|.....::..|..||:.::.|..::|||.||:|.||..:..|.:.:|:
  Fly   130 MITLVFWAALYPSM-PGMGAELYNLWAHAFNSICLVFDCFMVAFPTRIMHFVYPFTAGITYGVFS 193

  Fly   203 LIYHLCGGTDEFGNHYVYPILDWNNPNRCMVTFVGIFLLIMCYWVLLFGLYKLK 256
            |||...||.|..||.::|.||||..|...:.|..|..:|:.|:.||:||.|:|:
  Fly   194 LIYFWAGGMDPMGNRFIYFILDWERPGLAIGTVCGCVVLVSCFCVLVFGFYRLR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rostNP_001260274.1 Far-17a_AIG1 52..254 CDD:147085 69/201 (34%)
CG9555NP_001285770.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48361
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 1 1.000 - - FOG0009967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.