DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rost and CG13101

DIOPT Version :9

Sequence 1:NP_001260274.1 Gene:rost / 34222 FlyBaseID:FBgn0011705 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_609264.1 Gene:CG13101 / 34221 FlyBaseID:FBgn0032084 Length:318 Species:Drosophila melanogaster


Alignment Length:253 Identity:88/253 - (34%)
Similarity:144/253 - (56%) Gaps:10/253 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KELQRANFGFAYNRVHLFYRSQWQKDEINTIYLLYRWIWALFFLGVYIMCVIVQFCDGK----FF 73
            ||.||.:.||.::....|.:||||....:..||.|||..|:||:.|.|:.:..:..|..    :|
  Fly    16 KEFQRKSCGFDHDTPDDFVKSQWQSCTKSMAYLFYRWFMAMFFVVVVIISMWPETDDATSYWLYF 80

  Fly    74 IYMTNWGFGLCTITMLISAVQVTCWHFDVRSTRSLVQESGHKAETSRGLKIYWWLYNMTLSLALI 138
            |||||||..:|.:|.::.|:.||.||:.......|:....:.:.    .::||.::.::|.|:::
  Fly    81 IYMTNWGIWMCMLTNVLGAILVTIWHYHPEYADKLLNMKSYFSY----FRLYWGMHIISLVLSIV 141

  Fly   139 ISTVYWVFLHGKMNKPMRFPAISIITHGMNSVMMLIDFLVIAFPLRILHMVYGMSLAIFFFLFTL 203
            |:.:||..|:......:  .|.:::||..||:.|.||..::|.|||:||:...:...:.|.:|:.
  Fly   142 ITIIYWSILYDANESAL--DATNVLTHAFNSICMFIDLWIVAHPLRLLHIFLPVLFGVVFAIFSY 204

  Fly   204 IYHLCGGTDEFGNHYVYPILDWNNPNRCMVTFVGIFLLIMCYWVLLFGLYKLKRMFNR 261
            |||||||.::.|..|:|.::||:.|.....|.||:.||..|.:||||..:||:...:|
  Fly   205 IYHLCGGINKKGKPYIYYVIDWSKPQNAFTTVVGVLLLSCCIYVLLFAFFKLRLFLHR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rostNP_001260274.1 Far-17a_AIG1 52..254 CDD:147085 69/205 (34%)
CG13101NP_609264.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 1 1.000 - - FOG0009967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.