DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13101 and AT1G10660

DIOPT Version :9

Sequence 1:NP_609264.1 Gene:CG13101 / 34221 FlyBaseID:FBgn0032084 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_172536.1 Gene:AT1G10660 / 837609 AraportID:AT1G10660 Length:320 Species:Arabidopsis thaliana


Alignment Length:307 Identity:60/307 - (19%)
Similarity:115/307 - (37%) Gaps:80/307 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKEFQRKSCGFDHDTPDD-FVKSQWQSCTKSMAYLFYRWFMAMFFVVVVIISMWPETDDAT---- 74
            |:..||:|   ..:.|.. |....|.:|.|.:..|:...|....||.::.:.:.....|..    
plant    40 KRRRQRES---QRELPGTLFQDEAWTTCFKRIHPLWLLAFRVFSFVAMLTLLISNVVRDGAGIFY 101

  Fly    75 --SYW------LYFIYMTNWGIWMCMLTNVLGAILVTIWHYHPEYADKLLNMKSYFSY------- 124
              :.|      |||.|.:...::.|.:             |:.|.:.   ||:||.|.       
plant   102 FYTQWTFTLVTLYFGYASVLSVYGCCI-------------YNKEASG---NMESYTSIGDTEQGT 150

  Fly   125 FRL---------------------------YWGMHIISLVL-----SIVIT-IIYWSILYDANES 156
            :|.                           :| ::|..::.     ::|:| |::|:|:|...:.
plant   151 YRPPIALDGEGNTSKASNRPSEAPARKTAGFW-VYIFQILFQTCAGAVVLTDIVFWAIIYPFTKG 214

  Fly   157 -ALDATNVLTHAFNSICMFIDLWIVAHPLRLLHIFLPVLFGVVFAIFSYIYHLCGGINKKGKPYI 220
             .|...:|..|:.|::.:..|..:.:....|..|...||:..:|..:.:|.|..     |...:.
plant   215 YKLSFLDVCMHSLNAVFLLGDTSLNSLRFPLFRIAYFVLWSCIFVAYQWIIHAV-----KNLWWP 274

  Fly   221 YYVIDWSKPQNAFTTVVGVLLLSCCIYVLLFAFFKLRLFLHRRCRNA 267
            |..:|.|.|. |....:||.::....:.:.....||:.:|.::..|:
plant   275 YQFLDLSSPY-APLWYLGVAVMHIPCFAVFALVIKLKNYLLQQRHNS 320



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.