DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13101 and AT3G27770

DIOPT Version :9

Sequence 1:NP_609264.1 Gene:CG13101 / 34221 FlyBaseID:FBgn0032084 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_566825.1 Gene:AT3G27770 / 822398 AraportID:AT3G27770 Length:315 Species:Arabidopsis thaliana


Alignment Length:234 Identity:42/234 - (17%)
Similarity:83/234 - (35%) Gaps:76/234 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 WLYFIYMTNWGIWMCMLTNVLGAILVTIW---HYHPE-----------------YADKLLN---- 117
            |..:.|.|.|...:..:...:|::| :|:   .|..:                 :...|::    
plant   100 WRIYYYYTQWTFTLIAIYFGMGSLL-SIYGCLQYKKQGNTGLIADQVGIDAENGFRSPLIDGDNM 163

  Fly   118 -------------MKSYFSYFRLYWGMHIISLVLSIVITIIYWSILY---DANESALDATNVLTH 166
                         :|||...|::.:.|...:.||:   ..|||::::   ...:..:....|..|
plant   164 VSFEKRKTSGSEALKSYVHLFQIIYQMGAGAAVLT---DSIYWTVIFPFLSLQDYEMSFMTVNLH 225

  Fly   167 AFNSICMFIDLWI--VAHPLRLLHIFLPVLFGVVFAIFSYIYHLCGGINKKGKPY---------- 219
            ..|.:.:.||.::  :..||.....|  :|:...|.:|.:|.|:...:   |.||          
plant   226 TSNLVLLLIDTFLNRLKFPLFRFSYF--ILWTGCFVLFQWILHMFISV---GWPYPFLNLSLDMA 285

  Fly   220 -IYYVIDWSKPQNAFTTVVGVLLLSCCIYVLLFAFFKLR 257
             ::|::              |.||....|.|.....|::
plant   286 PVWYLL--------------VALLHLPSYGLFALIVKIK 310



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.