DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13101 and AT2G47115

DIOPT Version :9

Sequence 1:NP_609264.1 Gene:CG13101 / 34221 FlyBaseID:FBgn0032084 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_566096.2 Gene:AT2G47115 / 819324 AraportID:AT2G47115 Length:300 Species:Arabidopsis thaliana


Alignment Length:224 Identity:46/224 - (20%)
Similarity:86/224 - (38%) Gaps:56/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WQSCTKSMA---YLFYR--WFMAMFFVVVVIISMWPETDDATSYWLYFIYMTNWGIW-------M 90
            |.||...:.   .||.|  .|::|..::...:..|    ||:    .|:|.|.|...       |
plant    60 WASCWTRLHPGWLLFTRSTSFLSMAALLAWDVIKW----DAS----IFVYYTEWTFMLVIIYFAM 116

  Fly    91 CMLTNVLGAIL------------VTIWHYHPEYADKL----LNMKSYFSYFRLYWGMHIISLVLS 139
            .::.:|.|.::            |.:.....|:..:|    ..|::.|.           :...:
plant   117 GIVASVYGCLIHLKELTLETDEDVVVEKVGDEFRRRLEVCGCFMQTIFQ-----------TSAGA 170

  Fly   140 IVIT-IIYWSILYDANESALDATNVLT---HAFNSICMFIDLWIVAHPLRLLHIFLPVLFGVVFA 200
            :|:| |::|.::.....:.....|.||   |..|:..:.::..:.:.|.....:...||:..::.
plant   171 VVLTDIVFWLVIVPFLSTTRFGLNTLTICMHTANAGFLLLETLLNSLPFPWFRMGYFVLWSCLYV 235

  Fly   201 IFSYIYHLCGGINKKGKPYIYYVIDWSKP 229
            ||.:|.|.||   ....||.:..:|  ||
plant   236 IFQWIIHACG---FTWWPYPFLELD--KP 259



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.