DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13101 and CG43778

DIOPT Version :9

Sequence 1:NP_609264.1 Gene:CG13101 / 34221 FlyBaseID:FBgn0032084 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001369129.1 Gene:CG43778 / 34738 FlyBaseID:FBgn0264308 Length:1003 Species:Drosophila melanogaster


Alignment Length:289 Identity:87/289 - (30%)
Similarity:143/289 - (49%) Gaps:35/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SCGFDHDTPD-----DFVKSQWQSCTK-SMAYLFYRWFMAMFFVVVVIISMWP--ETDD--ATSY 76
            || |...|||     :|...|||..|: .:.||||||..|:..:..::.|:..  .||:  ...|
  Fly   521 SC-FPEFTPDHVHRHNFYLCQWQRNTQVRIVYLFYRWITAITCLAALVCSLLDIGRTDEHFEHHY 584

  Fly    77 WLYFIYMTNWGIWMCMLTNVLGAILVTIWHYHPEYADKLLNMKSYFSYFRLYWGMHIISLVLSIV 141
            ..::||:|:||:..|.:...|.|.:||..........:::..........|||.::..:.|.:.:
  Fly   585 AKWWIYLTHWGLLFCTVQAWLAAWIVTQGMMVEREDFEIVRQAKKSRLHHLYWVLYTCATVYAFI 649

  Fly   142 ITIIYWSILYDANESALDATNVLTHAFNSICMFIDLWIVAHPLRLLHIFLPVLFGVVFAIFSYIY 206
            :|:.||.::::.....:||.|::.|..|:|.|.|||.||.||:::.|.:.....|:.:|||:.||
  Fly   650 VTMCYWLLVHNPEIHKIDALNIMVHVLNTIIMLIDLAIVGHPIKMSHAYFTTGIGLAYAIFTGIY 714

  Fly   207 HLCGGINKKGKPYIYYVIDWSKPQNAFTTVVGVLLLSCCIYVLLFAFFKLRLFLHRRC---RNAN 268
            .|.||.::|.:..||.::||:||..|      :::.:|.|   :|.|     |:|..|   ....
  Fly   715 FLAGGTDRKNQTAIYPMMDWTKPGKA------IIVTACAI---IFTF-----FVHFCCYLLYRGR 765

  Fly   269 FVLPTSAKSNGQTN-------GLDDKSGN 290
            ..|.|.....|:.|       ||:|.||:
  Fly   766 VWLFTKLCIRGRRNRDGEMGEGLNDDSGS 794



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZ8C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12242
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.