DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13101 and LOC103911277

DIOPT Version :9

Sequence 1:NP_609264.1 Gene:CG13101 / 34221 FlyBaseID:FBgn0032084 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_021332981.1 Gene:LOC103911277 / 103911277 -ID:- Length:326 Species:Danio rerio


Alignment Length:271 Identity:67/271 - (24%)
Similarity:131/271 - (48%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KKEFQRKSCGFDHDTPDDFVKSQWQSCTKSMAYLFYRWFMAMF----FVVVVIISMWPETDDATS 75
            |:||..:...|....|:..::.:|.  ...:.:|.||.||.::    |:...::...|:      
Zfish    12 KEEFTVQKLHFFTSKPELLLQPRWD--IPPVLWLVYRCFMLVYSLSWFIYTALLFNTPK------ 68

  Fly    76 YWLYFIYMTNWGIWMCMLT--------NVLGAIL-------------VTIWHYHPEYADKLLNMK 119
               :||::::  |..|::.        |:..|.|             |:|      ..:.||::.
Zfish    69 ---FFIFLSH--ISYCLMVIYYLLAFCNLAWAFLEIRCCSHRRKRAGVSI------ECEALLSLS 122

  Fly   120 -SYFSYFRLYWGMHIISLVLSIVITIIYWSILYDANESALDATNVLTHAFNSICMFIDLWIVAHP 183
             ..::...|.|.:|.:....|:.::.:||:|::.:::.:|.|.|:..|..||:...:||.:...|
Zfish   123 LPLYTALNLQWLLHSVMGCFSLSVSFLYWTIIHPSHQHSLTAFNINIHFINSVQTAVDLLLSCTP 187

  Fly   184 LRLLHIFLPVLFGVVFAIFSYIYHLCGGINKKGKPYIYYVIDW-SKPQNAFTTVVGVLLLSCCIY 247
            :.|.|...|||..:::.||:.:|.|.||.|:.|:||||.::|: .:|..|..:::||.|:  |:.
Zfish   188 VHLTHFIYPVLAAILYIIFAVVYWLMGGTNQSGQPYIYSILDFGGRPLLATLSILGVCLV--CLP 250

  Fly   248 VLLFAFFKLRL 258
            ......:||:|
Zfish   251 FCQLLLWKLQL 261



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1191165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.