Sequence 1: | NP_001260273.1 | Gene: | CG9541 / 34220 | FlyBaseID: | FBgn0032083 | Length: | 646 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011097.3 | Gene: | ADK2 / 856917 | SGDID: | S000000972 | Length: | 225 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 229 | Identity: | 52/229 - (22%) |
---|---|---|---|
Similarity: | 90/229 - (39%) | Gaps: | 63/229 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 356 LPPI-IWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEA---LAA 416
Fly 417 GDMAPEKSLNQLLETNLRQ---LRDRTGIIVDGYPRNLQQ------------------------- 453
Fly 454 ---VKYFENKY-----------KQRPPII--LLDCSKLQLGRGRIDDTVSSFRRRLELFREQTLP 502
Fly 503 MLKILDTSNRLQIVDGDTDSPSVQREFERLIRNH 536 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9541 | NP_001260273.1 | aden_kin_iso1 | 67..238 | CDD:130427 | |
ADK | 70..230 | CDD:238713 | |||
aden_kin_iso1 | 358..521 | CDD:130427 | 48/210 (23%) | ||
ADK | 359..521 | CDD:238713 | 47/209 (22%) | ||
ADK2 | NP_011097.3 | adk | 21..216 | CDD:234711 | 46/201 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23359 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |