DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and cmpk1

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001263603.1 Gene:cmpk1 / 733534 XenbaseID:XB-GENE-980040 Length:219 Species:Xenopus tropicalis


Alignment Length:210 Identity:52/210 - (24%)
Similarity:95/210 - (45%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 PPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTE-SFAVKEALAAGDMA 420
            |.:::|:||||:.|.|.|.:.| ...|:.|:|.|.|||   |...:.::: ...::..:..|.:.
 Frog    26 PFVVFVLGGPGAGKGTQCERIV-QKYGYTHLSAGDLLR---DERKKPDSQYGELIESYIRDGRIV 86

  Fly   421 PEKSLNQLLETNLRQLRDRTG----IIVDGYPRNLQQVKYFENKYKQRPP---IILLDCSK---- 474
            |.:....||:..:.|.....|    .::||:|||...::.:|.....:..   ::..||..    
 Frog    87 PVEITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCI 151

  Fly   475 ---LQLGR--GRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERLIR 534
               |:.|:  ||.||...|..:|::.:.:.|.|::.:.:.:.:::.||.   |.||...|     
 Frog   152 ERCLERGKSSGRSDDNRESLEKRIQTYLQSTRPIIDLYEKTGKVKKVDA---SKSVDEVF----- 208

  Fly   535 NHIQRLLNKTDDIDD 549
                   .|..||.|
 Frog   209 -------TKVQDIFD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 43/179 (24%)
ADK 359..521 CDD:238713 43/178 (24%)
cmpk1NP_001263603.1 UMP_CMP_kin_fam 28..216 CDD:273576 50/206 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.