Sequence 1: | NP_001260273.1 | Gene: | CG9541 / 34220 | FlyBaseID: | FBgn0032083 | Length: | 646 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079923.3 | Gene: | Cmpk1 / 66588 | MGIID: | 1913838 | Length: | 227 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 48/197 - (24%) |
---|---|---|---|
Similarity: | 94/197 - (47%) | Gaps: | 28/197 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 357 PPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTES---FAVKEALAAGD 418
Fly 419 MAPEKSLNQLLETNLRQL----RDRTGIIVDGYPRNLQQVKYFENKYKQRPP---IILLDCSK-- 474
Fly 475 -----LQLGR--GRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERL 532
Fly 533 IR 534 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9541 | NP_001260273.1 | aden_kin_iso1 | 67..238 | CDD:130427 | |
ADK | 70..230 | CDD:238713 | |||
aden_kin_iso1 | 358..521 | CDD:130427 | 43/181 (24%) | ||
ADK | 359..521 | CDD:238713 | 43/180 (24%) | ||
Cmpk1 | NP_079923.3 | UMP_CMP_kin_fam | 36..224 | CDD:273576 | 47/195 (24%) |
ADK | 36..215 | CDD:238713 | 46/187 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S511 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1378291at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.770 |