DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9541 and Cmpk1

DIOPT Version :9

Sequence 1:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_079923.3 Gene:Cmpk1 / 66588 MGIID:1913838 Length:227 Species:Mus musculus


Alignment Length:197 Identity:48/197 - (24%)
Similarity:94/197 - (47%) Gaps:28/197 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 PPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTES---FAVKEALAAGD 418
            |.:::|:||||:.|.|.|.:.|. ..|:.|:|.|.|||:     .|.|.:|   ..:::.:..|.
Mouse    34 PLVVFVLGGPGAGKGTQCARIVE-KYGYTHLSAGELLRD-----ERKNPDSQYGELIEKYIKEGK 92

  Fly   419 MAPEKSLNQLLETNLRQL----RDRTGIIVDGYPRNLQQVKYFENKYKQRPP---IILLDCSK-- 474
            :.|.:....||:..:.|.    ..:...::||:|||...::.:......:..   ::..||:.  
Mouse    93 IVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEI 157

  Fly   475 -----LQLGR--GRIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTDSPSVQREFERL 532
                 |:.|:  ||.||...|..:|::.:.|.|.|::.:.:...:::.:|.   |.||...|..:
Mouse   158 CIERCLERGKSSGRSDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKIDA---SKSVDEVFGEV 219

  Fly   533 IR 534
            ::
Mouse   220 VK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 43/181 (24%)
ADK 359..521 CDD:238713 43/180 (24%)
Cmpk1NP_079923.3 UMP_CMP_kin_fam 36..224 CDD:273576 47/195 (24%)
ADK 36..215 CDD:238713 46/187 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S511
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.